PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g11430.1.p
Common NameBRADI_2g11430, LOC100824371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 296aa    MW: 32792.4 Da    PI: 6.9494
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g11430.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-172471148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd ll+ ++k +G g+W+  ar  g++Rt+k+c++rw++yl
  Bradi2g11430.1.p 24 RGPWTVEEDVLLAGYIKAHGEGRWNELARLAGLRRTGKSCRLRWLNYL 71
                      89********************************************97 PP

2Myb_DNA-binding49.11.3e-1577120146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg ++++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Bradi2g11430.1.p  77 RGDFSPQEQLLILELHFRWGNR-WSRIAQELP-GRTDNEVKNYWRT 120
                       899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.171975IPR017930Myb domain
SuperFamilySSF466892.77E-2922118IPR009057Homeodomain-like
SMARTSM007171.7E-132373IPR001005SANT/Myb domain
PfamPF002494.0E-152471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-212578IPR009057Homeodomain-like
CDDcd001673.36E-102671No hitNo description
PROSITE profilePS5129416.876126IPR017930Myb domain
SMARTSM007176.0E-1476124IPR001005SANT/Myb domain
PfamPF002496.9E-1577120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2279125IPR009057Homeodomain-like
CDDcd001671.82E-1080120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MSTGMDAMWT AAGSEDSAAA ELRRGPWTVE EDVLLAGYIK AHGEGRWNEL ARLAGLRRTG  60
KSCRLRWLNY LRPGVRRGDF SPQEQLLILE LHFRWGNRWS RIAQELPGRT DNEVKNYWRT  120
RVQKHAKQLR CDVDSRQFQD VMRHLWMPRL AERIHAAARA SATTSSASST TSSEHAAATL  180
HPMYRPNNSL LGPMSDMPSP DTTTTWSTAT ARPSSGALFP SNQVSMAAAA PGCSADWSAG  240
SASARSDDMF DGSWSELLAR ACDDGADSLV FPDFGLGESR DNSWSLDDIW SQHQY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-242111824120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN5644281e-133FN564428.1 Triticum aestivum chromosome 3B-specific BAC library, contig ctg0091b.
GenBankHG6703061e-133HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565694.20.0PREDICTED: transcription factor MYB24-like
TrEMBLA0A0Q3FX810.0A0A0Q3FX81_BRADI; Uncharacterized protein
STRINGBRADI2G11430.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP1422434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.17e-75myb domain protein 112